ELISA Recombinant Equine herpesvirus 2 Glycoprotein N(53)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Equine herpesvirus 2 (strain 86/87) (EHV-2)
Uniprot NO.:Q66655
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SQNSTTPSKFPTFYSYDCNADTYAPQLTSFSTIWTLLNVLVMTIACVIYLIYMCFNKFVA TMTNT
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:Name:53
Expression Region:25-89
Sequence Info:fµLl length protein