ELISA Recombinant Equine herpesvirus 2 Glycoprotein N(53)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Equine herpesvirus 2 (strain 86/87) (EHV-2) Uniprot NO.:Q66655 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SQNSTTPSKFPTFYSYDCNADTYAPQLTSFSTIWTLLNVLVMTIACVIYLIYMCFNKFVA TMTNT Protein Names:Recommended name: Glycoprotein N Short name= gN Gene Names:Name:53 Expression Region:25-89 Sequence Info:fµLl length protein