Skip to Content

ELISA Recombinant Xenopus tropicalis Zinc transporter 8(slc30a8)

https://www.kxtbio.com/web/image/product.template/161638/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5XHB4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKGSEEAYLVSDKATKMYSLTKDSEKNHPSKPPLQDEENPQSKYHCHNNNKKAYDARQRE QTFAKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLCSLWLSSK SSTTRLTFGWHRAEILGALMSVITIWLVTGVLVYLACERLIRPDYTIDGTVmLITSACAL GANLVLALILHQSGHGHSHAGGKHEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLISA LIIYFKPEYKMADPICTFIFSIFVLITTVTVLRDLLTVLMEGTPRGIHYSDVKQSILAVD GVKSVHSLHLWALTMNQVILSAHIATDIVGESKRILKDVTQNVFARFPFHSVTIQVEPIE DQSPECMFCYEPTQ Protein Names:Recommended name: Zinc transporter 8 Short name= ZnT-8 Alternative name(s): Solute carrier family 30 member 8 Gene Names:Name:slc30a8 Expression Region:1-374 Sequence Info:fµLl length protein

1,730.00 € 1730.0 EUR 1,730.00 €

1,730.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days