ELISA Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM14(PAM18)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Uniprot NO.:Q6CEU0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTTPVQPLQSEPLMDSETGVAPQIEAPQVPEGPKKGIDEQIFDYFAEHPVQATAATLVG LYALGAVFKRPAAGARGQFFKGGFENKMGPSEALQILSLRDAGLTMNKLKGQHRKImLLN HPDRGGSPYVATKINEAKSVLEKRGGLK
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s): Presequence translocated-associated motor subunit PAM18
Gene Names:Name:PAM18 Synonyms:TIM14 Ordered Locus Names:YALI0B12958g
Expression Region:1-148
Sequence Info:fµLl length protein