ELISA Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM21(TIM21)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Uniprot NO.:Q6CAQ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SAAKAEGKPKVSAYEKANMRLAKIGVFFQLSWYLGIILAALGLFGLVWYYLIMELVMPSG DVRIFNRAFKEIEKNEDVMRVLGGQLSSMGEGGGGRWGRNQPPVSKRGIDKYGREHIWMN FYVSGDINEGRAKLELVQNTDSKLSSERFVYRYFVVDIPGHKRIYIAGNAAEKMEKKKST GWLGVNWGKSDDE
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM21
Gene Names:Name:TIM21 Ordered Locus Names:YALI0D00715g
Expression Region:77-269
Sequence Info:fµLl length protein