Skip to Content

ELISA Recombinant Xenopus tropicalis UPF0458 protein C7orf42 homolog

https://www.kxtbio.com/web/image/product.template/161624/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q68FB2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MILILHPLENLKSYISSRPPLVIFMVSVSGMAIAFLTLGYFFKMKEIKSPEMTEDWNTFL LRFNNLDLCVSENETLKHFLNETTPPESTVTSGQARSSTQTPQALEDSGPINISVAITLT LDPLKPFGGYSRNITHLSSTIFGHQIGLSGRDSHEEMNITFTLPAAWNSDDCIVHGHCEQ VVFTTCMTVTAASSVFPVTVQPPHCIPETYSNASLWYKIFTTARDSGTKYAQDYNPFWCY KGAVGKVYHALNPKLTVIVPEDDRSLINLHLMDTSYFLFVMVITMFCYAVIRGRPSKLRQ SNSEFSPEKVALSDA Protein Names:Recommended name: UPF0458 protein C7orf42 homolog Gene Names: Expression Region:1-315 Sequence Info:fµLl length protein

1,667.00 € 1667.0 EUR 1,667.00 €

1,667.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days