ELISA Recombinant Debaryomyces hansenii Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (TorµLaspora hansenii)
Uniprot NO.:Q6BXM0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPADIPKSVVQKLVFFTAAMIICPVATFFICQYLFSNNAIISGGVSALVANIVLIGYVVA AFMEDTTEQEPEETKKSR
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:VMA21 Ordered Locus Names:DEHA2B01892g
Expression Region:1-78
Sequence Info:fµLl length protein