Skip to Content

ELISA Recombinant Yarrowia lipolytica Mitochondrial import inner membrane translocase subunit TIM50(TIM50)

https://www.kxtbio.com/web/image/product.template/161716/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6CDV7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SDKKTEKSDQPFQSSLLNDDLLAQAGMDVDESKGKSKPAAEGKSEGAAEGATEDDVTDEQ RARWAGTAKKSTDQTSKQESRERIAGYGYYAFFAGSAAFAAYLARDWDNEEDKKKHDTIG QGYTPmLMWARLKARIGDTFSFYRDPVAPVLLPDPPAPPYQRPLTLVIALDDLLVHQEWS REHGWRVAKRPGVDYFLGYLGQYYEIVLFSSQYMANCEKLIMKLDPYHAWFSHVLTREHT TYEDGKLVKDLSLMNRDMGKIIIIDPDTGCTMKQPENSIPIEPWKGTPGDKELVKLIPFL EWLVSQNVNDVRPILKAFDGTYLPDEFTRREAIAREKFEKDWYAKHGKDGQWASKFLGVS EPKQQKPLMPHDVMRREGQKQYQKFLEYLAVEGPKLKAEEERMIAEQKAMGPKNLSEAVS SIGSLPPVPQQPTEPKA Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM50 Gene Names:Name:TIM50 Ordered Locus Names:YALI0B20856g Expression Region:30-466 Sequence Info:fµLl length protein

1,796.00 € 1796.0 EUR 1,796.00 €

1,796.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days