ELISA Recombinant Yaba monkey tumor virus E3 ubiquitin-protein ligase LAP(LAP)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yaba monkey tumor virus (strain VR587) (YMTV)
Uniprot NO.:Q6TV02
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHY FSRWKWCFSDKKTVLSKILFIFFAVGFIFITTSMSSNVASLVTRIDDTFFDVVFLTVYIS MILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV
Protein Names:Recommended name: E3 ubiquitin-protein ligase LAP EC= 6.3.2.- Alternative name(s): Leukemia associated protein Short name= LAP
Gene Names:Name:LAP ORF Names:5L
Expression Region:1-156
Sequence Info:fµLl length protein