Skip to Content

ELISA Recombinant Yaba monkey tumor virus E3 ubiquitin-protein ligase LAP(LAP)

https://www.kxtbio.com/web/image/product.template/161686/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yaba monkey tumor virus (strain VR587) (YMTV) Uniprot NO.:Q6TV02 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHY FSRWKWCFSDKKTVLSKILFIFFAVGFIFITTSMSSNVASLVTRIDDTFFDVVFLTVYIS MILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV Protein Names:Recommended name: E3 ubiquitin-protein ligase LAP EC= 6.3.2.- Alternative name(s): Leukemia associated protein Short name= LAP Gene Names:Name:LAP ORF Names:5L Expression Region:1-156 Sequence Info:fµLl length protein

1,500.00 € 1500.0 EUR 1,500.00 €

1,500.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days