Skip to Content

ELISA Recombinant Xenopus tropicalis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(sdhd)

https://www.kxtbio.com/web/image/product.template/161572/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6P355 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LLIRPVPCLTQDHHMVQTSQIHTSPNHHAGSKAASMHWTSERALSVALLGLLPAAYLYPG AAMDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKMANTSLFALSALTFAGLCYFNYHDVG ICKAVSmLWSL Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cytochrome b small subu Gene Names:Name:sdhd ORF Names:TNeu097k19.1 Expression Region:22-152 Sequence Info:fµLl length protein

1,473.00 € 1473.0 EUR 1,473.00 €

1,473.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days