ELISA Recombinant Drosophila melanogaster UPF0466 protein CG17680, mitochondrial(CG17680)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila melanogaster (Fruit fly)
Uniprot NO.:Q7JX57
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDD ED
Protein Names:Recommended name: UPF0466 protein CG17680, mitochondrial
Gene Names:ORF Names:CG17680
Expression Region:36-97
Sequence Info:fµLl length protein