Skip to Content

ELISA Recombinant Xylella fastidiosa Lipoprotein-releasing system transmembrane protein LolC(lolC)

https://www.kxtbio.com/web/image/product.template/161657/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xylella fastidiosa (strain TemecµLa1 / ATCC 700964) Uniprot NO.:Q87EF5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFNPLSVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL QMSAHATVSAQGAPMHDWQHAVALAMTDPRVAGAAPYIESEALLQGERHQPAMMRGIVPN QETKVSVLAQKLKVGSIDSLKPGEYNILLGKELALWLGVDVGDSVIVLLSQTQTTPVGTM PRMKRFTVSGLFEVGYNEIDRGLAVVNMEDMQKIMRMDGVTGVRLKLHDMDHAWDVASDL AVRLNGPYLVSDWTRENANLYSSLKMEKTVMGILLSLIIAMGAFNLVSSQVmLVTDKQAD IAILRTLGLSPAGVMRVFMVQGSLIGIIGTLSGVIGGVVLTWNLERILKLIESTFNITLL PEDVYYITGLPTDMQFPDVVVITLMALAMSFIATLYPAWRAARIQPAEALRYE Protein Names:Recommended name: Lipoprotein-releasing system transmembrane protein LolC Gene Names:Name:lolC Ordered Locus Names:PD_0356 Expression Region:1-413 Sequence Info:fµLl length protein

1,771.00 € 1771.0 EUR 1,771.00 €

1,771.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days