ELISA Recombinant Zinc transporter zitB(zitB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O157:H7 Uniprot NO.:Q8X400 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAHSHTSSHLPEDNNARRLLYAFGVTAGFmLVEVIGGFLSGSLALLADAGHmLTDTAALL FALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVEGG MMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWTGW TPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVHHV HVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHATIQMEYQPCHGPDCHLN EGVSGHSHHHH Protein Names:Recommended name: Zinc transporter zitB Gene Names:Name:zitB Ordered Locus Names:Z0922, ECs0780 Expression Region:1-311 Sequence Info:fµLl length protein