ELISA Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA(aaeA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pestis Uniprot NO.:Q8ZAU9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALS QEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG Protein Names:Recommended name: p-hydroxybenzoic acid efflux pump subunit AaeA Short name= pHBA efflux pump protein A Gene Names:Name:aaeA Ordered Locus Names:YPO3685, y0178, YP_3858 Expression Region:1-311 Sequence Info:fµLl length protein