Skip to Content

ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10(PCR10)

https://www.kxtbio.com/web/image/product.template/117039/image_1920?unique=a9584cd
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q8S8T8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKEKKGHYVPPSYIPLTQSDADTEVETTTPNLEIAVSESTKDDPRQWSSGICACFDDMQS CCVGLFCPCYIFGKNAELLGSGTFAGPCLTHCISWALVNTICCFATNGALLGLPGCFVSC YACGYRKSLRAKYNLQEAPCGDFVTHFFCHLCAICQEYREIREQSSGSYPLDMKMAITNA PLAQTMESAN Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 10 Short name= AtPCR10 Gene Names:Name:PCR10 Ordered Locus Names:At2g40935 ORF Names:T20B5 Expression Region:1-190 Sequence Info:fµLl length protein

1,536.00 € 1536.0 EUR 1,536.00 €

1,536.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days