ELISA Recombinant Zinc transporter zitB(zitB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pestis Uniprot NO.:Q8ZGY6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVSTIFSQDSNSKRLLIAFAITTLFMVTEAIGGWLSGSLALLADAGHmLTDSAALFIAL MAVHFSQRKPDPRHTFGYLRLTTLAAFVNAAALLLIVILIVWEAVHRFFSPHEVMGTPmL IIAIAGLLANIFCFWILHKGEEEKNINVRAAALHVLSDLLGSVGAMIAAIVILTTGWTPI DPILSVLVSVLILRSAWRLLKESFHELLEGAPQEIDINKLRKDLCTNIYEVRNIHHVHLW QVGEQRLMTLHAQVIPPLDHDALLQRIQDYLLHHYRISHATVQMEYQHCGTPDCGINQAA PADGHHRHHHHE Protein Names:Recommended name: Zinc transporter zitB Gene Names:Name:zitB Ordered Locus Names:YPO1129, y3050, YP_1027 Expression Region:1-312 Sequence Info:fµLl length protein