Skip to Content

ELISA Recombinant Zea mays Aquaporin PIP1-3-PIP1-4(PIP1-3)

https://www.kxtbio.com/web/image/product.template/162146/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9AQU5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGKEEDVRLGANKFSERQPIGTAAQGAGAGDDDKDYKEPPPAPLFEPGELKSWSFYRAG IAEFVATFLFLYITVLTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHIN PAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTK GDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGI NPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRAIPFKSRS Protein Names:Recommended name: Aquaporin PIP1-3/PIP1-4 Alternative name(s): Plasma membrane intrinsic protein 1-3 Plasma membrane intrinsic protein 1-4 ZmPIP1-3 ZmPIP1-4 ZmPIP1;3 ZmPIP1;4 Gene Names:Name:PIP1-3 ANDName: PIP1-4 Expression Region:1-292 Sequence Info:fµLl length protein

1,643.00 € 1643.0 EUR 1,643.00 €

1,643.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days