Skip to Content

ELISA Recombinant Yarrowia lipolytica Peroxisomal biogenesis factor 2(PEX2)

https://www.kxtbio.com/web/image/product.template/161731/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q99155 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSVLRLFKIGAPVPNVRVHQLDASLLDAELVDLLKNQLFKGFTNFHPEFRDKYESELVL ALKLILFKLTVWDHAITYGGKLQNLKFIDSRHSSKLQIQPSVIQKLGYGILVVGGGYLWS KIEGYLLARSEDDVATDGTSVRGASAARGALKVANFASLLYSAATLGNFVAFLYTGRYAT VIMRLLRIRLVPSQRTSSRQVSYEFQNRQLVWNAFTEFLIFILPLLQLPKLKRRIERKLQ SLNVTRVGNVEEASEGELAHLPQKTCAICFRDEEEQEGGGGASHYSTDVTNPYQADCGHV YCYVCLVTKLAQGDGDGWNCYRCAKQVQKMKPWVDVDEAAVVGAAEMHEKVDVIEHAEDN EQEEEEFDDDDEDSNFQLMKD Protein Names:Recommended name: Peroxisomal biogenesis factor 2 Alternative name(s): Peroxin-2 Peroxisomal protein PAY5 Gene Names:Name:PEX2 Synonyms:PAY5 Ordered Locus Names:YALI0F01012g Expression Region:1-381 Sequence Info:fµLl length protein

1,737.00 € 1737.0 EUR 1,737.00 €

1,737.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days