Skip to Content

ELISA Recombinant Zea mays Aquaporin TIP1-2(TIP1-2)

https://www.kxtbio.com/web/image/product.template/162160/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATM0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPVSRIAVGAPGELSHPDTAKAAVAEFISTLIFVFAGSGSGMAFSKLTDGGAATPAGLIA ASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLL LKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIG FIVGANILAGGAFDGASMNPAVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFIG QRPHQQLPTTAADY Protein Names:Recommended name: Aquaporin TIP1-2 Alternative name(s): Tonoplast intrinsic protein 1-2 ZmTIP1-2 ZmTIP1;2 Gene Names:Name:TIP1-2 Expression Region:1-254 Sequence Info:fµLl length protein

1,603.00 € 1603.0 EUR 1,603.00 €

1,603.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days