Skip to Content

ELISA Recombinant Zea mays Aquaporin SIP1-1(SIP1-1)

https://www.kxtbio.com/web/image/product.template/162156/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATM3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAMGATVRAAAADAVVTFLWVLCASALGASTAAVTSYLGVQEGAGHYALLVTTSLLSVLL FTFDLLCGALGGASFNPTDFAASYAAGLDSPSLFSVALRFPAQAAGAVGGALAISELMPA QYKHTLAGPSLKVDPHTGALAEGVLTFVITLTVLWVIVKGPRNVILKTLLLSTSIVSVIL AGAEYTGPSMNPANAFGWAYVNNWHNTWEQLYVYWICPFIGAmLAGWIFRVVFLPPAPKP KTKKA Protein Names:Recommended name: Aquaporin SIP1-1 Alternative name(s): Small basic intrinsic protein 1-1 ZmSIP1-1 ZmSIP1;1 Gene Names:Name:SIP1-1 Synonyms:SIP1A Expression Region:1-245 Sequence Info:fµLl length protein

1,594.00 € 1594.0 EUR 1,594.00 €

1,594.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days