Skip to Content

ELISA Recombinant Zea mays Aquaporin TIP4-3(TIP4-3)

https://www.kxtbio.com/web/image/product.template/162168/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATL4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGKLTLGHRGEASEPDFFRGVLGELVLTFLFVFIGVGAAMTDGATTKGSTAGGDLTAVAL GQALVVAVIATAGFHISGGHVNPAVTLSLAVGGHVTLFRSSLYIAAQmLASSAACFLLRW LTGGLATPVHALAEGVGPLQGVVAEAVFTFSLLFVIYATILDPRKLLPGAGPLLTGLLVG ANSVAGAALSGASMNPARSFGPAVASGVWTHHWVYWVGPLAGGPLAVLVYECCFMAAAPT HDLLPQQDP Protein Names:Recommended name: Aquaporin TIP4-3 Alternative name(s): Tonoplast intrinsic protein 4-3 ZmTIP4-3 ZmTIP4;3 Gene Names:Name:TIP4-3 Expression Region:1-249 Sequence Info:fµLl length protein

1,598.00 € 1598.0 EUR 1,598.00 €

1,598.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days