Skip to Content

ELISA Recombinant Zymomonas mobilis UPF0060 membrane protein ZMO1566(ZMO1566)

https://www.kxtbio.com/web/image/product.template/162293/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zymomonas mobilis (strain ATCC 31821 / ZM4 / CP4) Uniprot NO.:Q9RH13 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLALLYIPAALAEITGCFSFWAWIRLHKSPLWLLPGIASLLLFAWLLTFSPAENAGKAYA VYGGIYIIMSLLWSWKVEATPPDHWDLIGAAFCLVGAAIILWMPRSL Protein Names:Recommended name: UPF0060 membrane protein ZMO1566 Gene Names:Ordered Locus Names:ZMO1566 Expression Region:1-107 Sequence Info:fµLl length protein

1,448.00 € 1448.0 EUR 1,448.00 €

1,448.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days