ELISA Recombinant Zymomonas mobilis UPF0060 membrane protein ZMO1566(ZMO1566)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zymomonas mobilis (strain ATCC 31821 / ZM4 / CP4)
Uniprot NO.:Q9RH13
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:mLALLYIPAALAEITGCFSFWAWIRLHKSPLWLLPGIASLLLFAWLLTFSPAENAGKAYA VYGGIYIIMSLLWSWKVEATPPDHWDLIGAAFCLVGAAIILWMPRSL
Protein Names:Recommended name: UPF0060 membrane protein ZMO1566
Gene Names:Ordered Locus Names:ZMO1566
Expression Region:1-107
Sequence Info:fµLl length protein