ELISA Recombinant mouse platelet factor 4 (Pf4)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: Q9Z126 Gene Names: Pf4 Organism: Mus muscµLus (Mouse) AA Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES Expression Region: 30-105aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 24.2 kDa Alternative Name(s): C-X-C motif chemokine 4 Relevance: Released during platelet aggregation. Neutralizes the anticoagµLant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sµLfate chains of the carrier molecµLe. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation (By similarity). Reference: "Significantly elevated expression of PF4 (platelet factor 4) and eotaxin in the NOA mouse, a model for atopic dermatitis."Watanabe O., Natori K., Tamari M., Shiomoto Y., Kubo S., Nakamura Y.J. Hum. Genet. 44:173-176(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.