Skip to Content

ELISA Recombinant Yersinia enterocolitica Invasin,partial

https://www.kxtbio.com/web/image/product.template/161751/image_1920?unique=7c948e0
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Microbiology Target / Protein: Biologically active: Not Tested Expression system: E.coli Species of origin: Yersinia enterocolitica Delivery time: 3-7 business days Uniprot ID: P19196 AA Sequence: VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 651-835aa Protein length: Partial MW: 36.3 kDa Alternative Name(s): Relevance: Invasin is a protein that allows enteric bacteria to penetrate cµLtured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins. Reference: "Sequence, localization and function of the invasin protein of Yersinia enterocolitica."Young V.B., Miller V.L., Falkow S., Schoolnik G.K.Mol. Microbiol. 4:1119-1128(1990). Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days