ELISA Recombinant Yersinia pestis F1 capsule antigen(caf1)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: caf1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Yersinia pestis
Delivery time: 3-7 business days
Uniprot ID: P26948
AA Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Tag info: N-terminal 6xHis-tagged
Expression Region: 22-170aa
Protein length: FµLl Length of Mature Protein
MW: 19.6 kDa
Alternative Name(s):
Relevance:
Reference: "Nucleotide sequence of the Yersinia pestis gene encoding F1 antigen and the primary structure of the protein. Putative T and B cell epitopes." Galyov E.E., Smirnov O.Y., Karlishev A.V., Volkovoy K.I., Denesyuk A.I., Nazimov I.V., Rubtsov K.S., Abramov V.M., Dalvadyanz S.M., Zav'Yalov V.P. FEBS Lett. 277:230-232(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.