Skip to Content

ELISA RecombinantMouseAquaporin-4(Aqp4),partial

https://www.kxtbio.com/web/image/product.template/162296/image_1920?unique=7c948e0
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P55088 Gene Names: Aqp4 Organism: Mus muscµLus (Mouse) AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV Expression Region: 253-323aa Sequence Info: Partial Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 9.9 kDa Alternative Name(s): Mercurial-insensitive water channel Relevance: Forms a water-specific channel. Osmoreceptor which regµLates body water balance and mediates water flow within the central nervous system. Reference: "Defective secretion of saliva in transgenic mice lacking aquaporin-5 water channels." Ma T., Song Y., Gillespie A., Carlson E.J., Epstein C.J., Verkman A.S. J. Biol. Chem. 274:20071-20074(1999) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

904.00 € 904.0 EUR 904.00 €

904.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days